Antibodies

View as table Download

Rabbit polyclonal anti-CLN6 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CLN6.

Rabbit Polyclonal Anti-CLN6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLN6 antibody: synthetic peptide directed towards the C terminal of human CLN6. Synthetic peptide located within the following region: RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA

Rabbit Polyclonal Anti-CLN6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLN6 antibody: synthetic peptide directed towards the middle region of human CLN6. Synthetic peptide located within the following region: LPRSITYVSIIIFIMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNL