Antibodies

Jump to Filters
View as table Download
TMEM33 Rabbit Polyclonal Antibody
TA317436

USD 425.00

5 Days

TMEM33 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Monkey, Pig
Conjugation Unconjugated
Immunogen TMEM33 antibody was raised against synthetic 18 amino acid peptide from internal region of human TMEM33. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Dog, Bat, Elephant, Panda, Horse, Pig, Opossum, Platypus (100%); Mouse, Rat, Hamster, Rabbit, Turkey, Chicken, Lizard, Xenopus, Zebrafish (94%); Catfish, Salmon, Stickleback, Sea anemone (89%); Drosophila (83%).
TMEM33 Rabbit Polyclonal Antibody
TA342358

USD 375.00

5 Days

Rabbit Polyclonal Anti-Tmem33 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Tmem33 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LLHAATYTKKVLDAKGSNSLPLLRSVLDKLSTNQQNILKFIACNEIFLMP