Antibodies

Jump to Filters
View as table Download
MAGOH Goat Polyclonal Antibody
TA305811

USD 375.00

5 Days

Goat Anti-MAGOH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SLIGLHFKIKPI, from the C Terminus of the protein sequence according to NP_002361.1.
MAGOH Rabbit Polyclonal Antibody
TA342902

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAGOH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAGOH antibody: synthetic peptide directed towards the N terminal of human MAGOH. Synthetic peptide located within the following region: KLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPP