Antibodies

Jump to Filters
View as table Download
PPIL1 Rabbit Polyclonal Antibody
TA338053

USD 375.00

5 Days

Rabbit Polyclonal Anti-PPIL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIL1 antibody is: synthetic peptide directed towards the N-terminal region of Human PPIL1. Synthetic peptide located within the following region: YWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASI
PPIL1 Rabbit Polyclonal Antibody
TA350297

USD 345.00

In Stock

Rabbit Polyclonal Anti-PPIL1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein