Antibodies

Jump to Filters
View as table Download
ACTG2 Rabbit Polyclonal Antibody
TA313418

USD 345.00

In Stock

Rabbit polyclonal anti-Actin-gamma2 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Actin-?2.
ACTG2 Rabbit Polyclonal Antibody
TA347641

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Actin-gamma2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Actin-gamma2 Antibody: A synthesized peptide derived from human Actin-gamma2
ACTG2 Rabbit Polyclonal Antibody
TA338267

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACTG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTG2 antibody is: synthetic peptide directed towards the C-terminal region of Human ACTG2. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRK