Antibodies

View as table Download

Rabbit anti-AHSG Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human AHSG

Rabbit Polyclonal Anti-AHSG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AHSG antibody: synthetic peptide directed towards the N terminal of human AHSG. Synthetic peptide located within the following region: AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL

Rabbit Polyclonal Anti-AHSG Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human AHSG

AHSG rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human AHSG