Antibodies

View as table Download

Rabbit Polyclonal Anti-AKTIP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AKTIP Antibody: synthetic peptide directed towards the middle region of human AKTIP. Synthetic peptide located within the following region: NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA

AKTIP Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-292 of human AKTIP (NP_071921.1).
Modifications Unmodified