Antibodies

View as table Download

Rabbit Polyclonal Anti-Ankra2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ankra2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ankra2. Synthetic peptide located within the following region: VAMGMKFILPNRFDMNVCSRFVKSLNEEDSKNIQDQVNSDLEVASVLFKA

Rabbit Polyclonal Anti-ANKRA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANKRA2 antibody: synthetic peptide directed towards the C terminal of human ANKRA2. Synthetic peptide located within the following region: YAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESH

Anti-ANKRA2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 299-313 amino acids of human ankyrin repeat, family A (RFXANK-like), 2

Anti-ANKRA2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 299-313 amino acids of human ankyrin repeat, family A (RFXANK-like), 2