Antibodies

Jump to Filters
View as table Download
CHN 1 (CHN1) Rabbit Polyclonal Antibody
TA340026

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHN1 antibody: synthetic peptide directed towards the middle region of human CHN1. Synthetic peptide located within the following region: KVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIE
CHN 1 (CHN1) Rabbit Polyclonal Antibody
TA374754

USD 220.00

3 Weeks

CHN1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CHN1 (NP_001813.1).
Modifications Unmodified