Antibodies

View as table Download

Rabbit polyclonal CNBP Antibody (Center)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This CNBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-118 amino acids from the Central region of human CNBP.

Goat Polyclonal Antibody against CNBP

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence GESGHLARECTIE, from the C Terminus of the protein sequence according to NP_003409.1.

Rabbit Polyclonal Anti-CNBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNBP antibody: synthetic peptide directed towards the N terminal of human CNBP. Synthetic peptide located within the following region: SSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLP

CNBP rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CNBP

CNBP rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CNBP

CNBP Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human CNBP (NP_001120668.1).
Modifications Unmodified