USD 475.00
5 Days
Rabbit Polyclonal Anti-CNOT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT3 antibody: synthetic peptide directed towards the C terminal region of human CNOT3. Synthetic peptide located within the following region: MMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLEDRDL |
USD 375.00
5 Days
Rabbit Polyclonal Anti-CNOT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CNOT3 Antibody: synthetic peptide directed towards the N terminal of human CNOT3. Synthetic peptide located within the following region: QFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRML |
USD 310.00
5 Days
Rabbit Polyclonal Anti-CNOT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CNOT3 Antibody: synthetic peptide directed towards the N terminal of human CNOT3. Synthetic peptide located within the following region: QFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRML |
Germany
Japan
United Kingdom
China