Antibodies

View as table Download

Rabbit Polyclonal Anti-DHTKD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHTKD1 antibody is: synthetic peptide directed towards the N-terminal region of Human DHTKD1. Synthetic peptide located within the following region: YCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQE

DHTKD1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DHTKD1

DHTKD1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DHTKD1

DHTKD1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human DHTKD1 (NP_061176.3).
Modifications Unmodified