Antibodies

View as table Download

Rabbit Polyclonal Anti-ZNF312 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF312 antibody: synthetic peptide directed towards the C terminal of human ZNF312. Synthetic peptide located within the following region: THNDKKPFTCATCGKGFCRNFDLKKHVRKLHDSVGPAAPSAKDLTRTVQS

Rabbit Polyclonal Anti-ZNF312 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF312 Antibody: synthetic peptide directed towards the N terminal of human ZNF312. Synthetic peptide located within the following region: MASSASLETMVPPACPRAGASPATSKTLAFSIERIMAKTSEPRAPFEPRP

FEZF2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human FEZF2 (NP_060478.3).
Modifications Unmodified