Antibodies

View as table Download

USD 300.00

In Stock

Goat Polyclonal Anti-Rab8 Antibody

Applications IF, WB
Reactivities Human, Rat, Mousse, Canine, Monkey
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 107 aa to the C-terminus of mouse Rab8a and Rab8b produced in E. coli.

Goat Polyclonal Antibody against RAB8A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NQGVKITPDQQKR, from the C Terminus of the protein sequence according to NP_005361.2.

Rabbit Polyclonal Anti-RAB8A Antibody

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB8A antibody: synthetic peptide directed towards the middle region of human RAB8A. Synthetic peptide located within the following region: GIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP

Anti-RAB8A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 173-187 amino acids of Human Ras-related protein Rab-8A

Rabbit Polyclonal Anti-RAB8A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RAB8A

RAB8A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RAB8A