Antibodies

View as table Download

Rabbit Polyclonal Anti-RAD51D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD51D antibody is: synthetic peptide directed towards the C-terminal region of Human RAD51D. Synthetic peptide located within the following region: RLKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSRQPTGFQEM

Rad51D Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-328 of human Rad51D (NP_002869.3).
Modifications Unmodified

Rad51D Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-328 of human Rad51D (NP_002869.3).
Modifications Unmodified