Antibodies

View as table Download

Anti-Human RELMβ Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human RELMβ

Anti-Murine RELMβ Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine RELMβ

Rabbit polyclonal anti-RELM-beta antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed recombinant human RELM-β

Biotinylated Anti-Human RELMβ Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human RELMβ

Biotinylated Anti-Murine RELMβ Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine RELMβ

Rabbit Polyclonal Anti-RETNLB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RETNLB antibody: synthetic peptide directed towards the N terminal of human RETNLB. Synthetic peptide located within the following region: CSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVT

Anti-RETNLB Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 24-111 amino acids of human resistin like beta

Anti-RETNLB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 24-111 amino acids of human resistin like beta

RETNLB Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human RETNLB (NP_115968.1).

RETNLB Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human RETNLB (NP_115968.1).