Antibodies

Jump to Filters
View as table Download
SCMH1 Rabbit Polyclonal Antibody
TA308122

USD 415.00

In Stock

Rabbit polyclonal antibody to SCMH1 (sex comb on midleg homolog 1 (Drosophila))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 29 and 285 of SCMH1 (Uniprot ID#Q96GD3)
SCMH1 Rabbit Polyclonal Antibody
TA329388

USD 375.00

5 Days

Rabbit Polyclonal anti-SCMH1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCMH1 antibody: synthetic peptide directed towards the middle region of human SCMH1. Synthetic peptide located within the following region: LTGDNLQPPGTKVVIPKNPYPASDVNTEKPSIHSSTKTVLEHQPGQRGRK
SCMH1 Rabbit Polyclonal Antibody
TA330237

USD 375.00

5 Days

Rabbit Polyclonal Anti-SCMH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCMH1 antibody: synthetic peptide directed towards the middle region of human SCMH1. Synthetic peptide located within the following region: KTAEPLKFPKKRGPKPGSKRKPRTLLNPPPASPTTSTPEPDTSTVPQDAA
SCMH1 Rabbit Polyclonal Antibody
TA370248

USD 380.00

4 Weeks

SCMH1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SCMH1