Antibodies

Jump to Filters
View as table Download
SPRED2 Rabbit Polyclonal Antibody
TA306663

USD 430.00

5 Days

Rabbit Polyclonal Spred2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Spred2 antibody was raised against a 13 amino acid peptide near the center of the human Spred2.
SPRED2 Rabbit Polyclonal Antibody
TA342931

USD 375.00

5 Days

Rabbit Polyclonal Anti-SPRED2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPRED2 antibody: synthetic peptide directed towards the C terminal of human SPRED2. Synthetic peptide located within the following region: NHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGDYTDPCS