Rabbit Polyclonal Spred2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Spred2 antibody was raised against a 13 amino acid peptide near the center of the human Spred2. |
Rabbit Polyclonal Spred2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Spred2 antibody was raised against a 13 amino acid peptide near the center of the human Spred2. |
Rabbit Polyclonal Anti-SPRED2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SPRED2 antibody: synthetic peptide directed towards the C terminal of human SPRED2. Synthetic peptide located within the following region: NHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGDYTDPCS |