Rabbit polyclonal Syntaxin 1A (Ser14) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Syntaxin 1A around the phosphorylation site of serine 14 (K-D-SP-D-D) |
| Modifications | Phospho-specific |
Rabbit Polyclonal Syntaxin 1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Syntaxin 1A |
Rabbit Polyclonal Syntaxin 1A (Ser14) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Syntaxin 1A around the phosphorylation site of Serine 14 |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against STX1A / STX1B2
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KDRTQELRTAKD-C, from the N Terminus of the protein sequence according to NP_004594.1; NP_443106.1. |
Rabbit Polyclonal Anti-STX1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STX1A antibody: synthetic peptide directed towards the N terminal of human STX1A. Synthetic peptide located within the following region: KDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENV |
Anti-STX1A Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-15 amino acids of human syntaxin 1A (brain) |
STX1A Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-288 of human STX1A (NP_004594.1). |
| Modifications | Unmodified |
STX1A Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human STX1A |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
