Rabbit Polyclonal Anti-STX7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STX7 antibody: synthetic peptide directed towards the N terminal of human STX7. Synthetic peptide located within the following region: PSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVS |
Rabbit Polyclonal Anti-STX7 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human STX7 |
STX7 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human STX7 |
STX7 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human STX7 (NP_003560.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China