Antibodies

View as table Download

Rabbit Polyclonal Anti-EARS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EARS2 antibody: synthetic peptide directed towards the middle region of human EARS2. Synthetic peptide located within the following region: TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL

Carrier-free (BSA/glycerol-free) EARS2 mouse monoclonal antibody,clone OTI2B1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EARS2 mouse monoclonal antibody,clone OTI2C1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EARS2 mouse monoclonal antibody,clone OTI2B1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EARS2 mouse monoclonal antibody,clone OTI2B1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EARS2 mouse monoclonal antibody,clone OTI2C1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EARS2 mouse monoclonal antibody,clone OTI2C1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated