Antibodies

Jump to Filters
View as table Download
CD40L (CD40LG) Capture Mouse Monoclonal Antibody [Clone ID: MK13A4]
TA600027

USD 379.00

In Stock

CD40L Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MK13A4

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700027
CD40L (CD40LG) Rabbit Polyclonal Antibody
TA334291

USD 375.00

5 Days

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN
CD40L (CD40LG) Mouse Monoclonal Antibody [Clone ID: 24-31]
TA320280

USD 170.00

5 Days

Mouse Anti-Human CD154 (CD40 Ligand) Purified (25 ug)

Reactivities Human
Conjugation Unconjugated
CD40L (CD40LG) Rabbit Polyclonal Antibody
TA354175

USD 355.00

5 Days

Rabbit anti CD154 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to aa 51-69 of human CD154.
CD40L (CD40LG) Rabbit Polyclonal Antibody
TA349779

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CD40LG