Antibodies

Jump to Filters
View as table Download
Collagen VI (COL6A1) Rabbit Polyclonal Antibody
TA338915

USD 375.00

5 Days

Rabbit Polyclonal Anti-COL6A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COL6A1 antibody: synthetic peptide directed towards the middle region of human COL6A1. Synthetic peptide located within the following region: ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ
Collagen VI (COL6A1) Mouse Monoclonal Antibody [Clone ID: OTI1G8]
CF812064

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) COL6A1 mouse monoclonal antibody,clone OTI1G8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated