Antibodies

Jump to Filters
View as table Download
GALT Rabbit Polyclonal Antibody
TA346668

USD 475.00

5 Days

Rabbit Polyclonal Anti-GALT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALT antibody: synthetic peptide directed towards the C terminal of human GALT. Synthetic peptide located within the following region: LLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYHLGQKDRET
GALT Rabbit Polyclonal Antibody
TA350006

USD 345.00

In Stock

Rabbit Polyclonal Anti-GALT Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GALT