Antibodies

Jump to Filters
View as table Download
SUV39H2 Rabbit Polyclonal Antibody
TA332964

USD 275.00

3 Weeks

Rabbit anti-SUV39H2 Polyclonal Antibody

Applications ChIP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SUV39H2
SUV39H2 Rabbit Polyclonal Antibody
TA346829

USD 475.00

5 Days

Rabbit Polyclonal Anti-SUV39H2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUV39H2 antibody: synthetic peptide directed towards the middle region of human SUV39H2. Synthetic peptide located within the following region: LDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRT
SUV39H2 Rabbit Polyclonal Antibody
TA315801

USD 345.00

In Stock

Rabbit polyclonal anti-SUV39H2 antibody

Applications WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SUV39H2.