Antibodies

View as table Download

Anti-Human FGF-16 Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human FGF-16

Rabbit Polyclonal Anti-FGF16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF16 antibody is: synthetic peptide directed towards the C-terminal region of Human FGF16. Synthetic peptide located within the following region: REQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTH

Rabbit Polyclonal Anti-FGF16 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FGF16