Antibodies

Jump to Filters
View as table Download
FGF14 Goat Polyclonal Antibody
TA311394

USD 375.00

5 Days

Goat Anti-Fgf14 (mouse N terminus) Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence REQHWDRPSASR-C, from the N Terminus of the protein sequence according to NP_034331.2; NP_997550.1.
FGF14 Rabbit Polyclonal Antibody
TA335069

USD 375.00

5 Days

Rabbit Polyclonal Anti-FGF14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF14 antibody: synthetic peptide directed towards the middle region of human FGF14. Synthetic peptide located within the following region: ENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKP