Antibodies

View as table Download

P2Y10 / P2RY10 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human, Monkey, Gorilla
Conjugation Unconjugated
Immunogen P2Y10 / P2RY10 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human P2RY10 / P2Y10. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%).

Rabbit Polyclonal Anti-P2RY10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-P2RY10 Antibody is: synthetic peptide directed towards the N-terminal region of Human P2RY10. Synthetic peptide located within the following region: NLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLAN