Rabbit Polyclonal Anti-ATP5F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP5F1 antibody: synthetic peptide directed towards the middle region of human ATP5F1. Synthetic peptide located within the following region: VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST |
Rabbit polyclonal anti-ATP5F1 antibody (Center)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This ATP5F1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 161-195 amino acids from the Central region of human ATP5F1. |
ATP5F1 (aa142-153) Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Internal region (SIQHIQNAIDTE) |
Germany
Japan
United Kingdom
China
