Antibodies

Jump to Filters
View as table Download
SFRS7 (SRSF7) Rabbit Polyclonal Antibody
TA314524

USD 345.00

In Stock

Rabbit polyclonal anti-SFRS7 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SFRS7.
SFRS7 (SRSF7) Rabbit Polyclonal Antibody
TA336041

USD 375.00

5 Days

Rabbit Polyclonal Anti-SFRS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SFRS7 Antibody: synthetic peptide directed towards the N terminal of human SFRS7. Synthetic peptide located within the following region: MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFA
SFRS7 (SRSF7) Rabbit Polyclonal Antibody
TA336042

USD 375.00

5 Days

Rabbit Polyclonal Anti-SFRS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SFRS7 Antibody: synthetic peptide directed towards the middle region of human SFRS7. Synthetic peptide located within the following region: SRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSP