Antibodies

View as table Download

Rabbit polyclonal antibody to IDI1 (isopentenyl-diphosphate delta isomerase 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 173 of IDI1 (Uniprot ID#Q13907)

Rabbit Polyclonal Anti-IDI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IDI1 antibody: synthetic peptide directed towards the middle region of human IDI1. Synthetic peptide located within the following region: PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA