Antibodies

View as table Download

Rabbit Polyclonal Anti-HPD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HPD antibody: synthetic peptide directed towards the middle region of human HPD. Synthetic peptide located within the following region: EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV

Rabbit Polyclonal TAT Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Anti-COQ6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COQ6 antibody is: synthetic peptide directed towards the N-terminal region of Human COQ6. Synthetic peptide located within the following region: ILLLEAGPKKVLEKLSETYSNRVSSISPGSATLLSSFGAWDHICNMRYRA

Carrier-free (BSA/glycerol-free) TAT mouse monoclonal antibody,clone OTI3G6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-TAT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 250 amino acids of human tyrosine aminotransferase

COQ7 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

COQ7 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

COQ6 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

TAT mouse monoclonal antibody,clone OTI3G6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TAT mouse monoclonal antibody,clone OTI3G6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated