Antibodies

View as table Download

Rabbit Polyclonal Anti-MYH1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MYH1

Rabbit Polyclonal Anti-MYH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYH1 antibody: synthetic peptide directed towards the N terminal of human MYH1. Synthetic peptide located within the following region: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK

Mouse monoclonal Anti-Slow Skeletal Muscle Myosin Heavy Chain Clone 96J

Reactivities Chicken, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated

Mouse monoclonal Anti-Slow Skeletal Muscle Myosin Heavy Chain (SM1) Clone M14

Reactivities Chicken, Human, Mouse, Rat
Conjugation Unconjugated

Mouse monoclonal Anti-Striated Muscle Myosin Heavy Chains (SM1 and SM2) Clone 83B6

Reactivities Chicken, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated