Antibodies

View as table Download

Rabbit anti-ABAT Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABAT

Rabbit Polyclonal Anti-ABAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABAT antibody: synthetic peptide directed towards the middle region of human ABAT. Synthetic peptide located within the following region: YRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATT

Rabbit Polyclonal Anti-ABAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABAT antibody: synthetic peptide directed towards the middle region of human ABAT. Synthetic peptide located within the following region: IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI6H1 (formerly 6H1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI7C4 (formerly 7C4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI6H9 (formerly 6H9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI6C9 (formerly 6C9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI7H1 (formerly 7H1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI7E9 (formerly 7E9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ABAT mouse monoclonal antibody, clone OTI6H1 (formerly 6H1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody, clone OTI6H1 (formerly 6H1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ABAT mouse monoclonal antibody, clone OTI7C4 (formerly 7C4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody, clone OTI7C4 (formerly 7C4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ABAT mouse monoclonal antibody, clone OTI6H9 (formerly 6H9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ABAT mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ABAT mouse monoclonal antibody, clone OTI6C9 (formerly 6C9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody, clone OTI6C9 (formerly 6C9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ABAT mouse monoclonal antibody, clone OTI7H1 (formerly 7H1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody, clone OTI7H1 (formerly 7H1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ABAT mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ABAT mouse monoclonal antibody, clone OTI7E9 (formerly 7E9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody, clone OTI7E9 (formerly 7E9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ABAT mouse monoclonal antibody,clone UMAB178

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody,clone UMAB178

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody,clone UMAB179

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody,clone UMAB179

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody,clone UMAB180

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody,clone UMAB180

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody,clone UMAB178

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ABAT mouse monoclonal antibody,clone UMAB179

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ABAT mouse monoclonal antibody,clone UMAB180

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".