Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-CCT8 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CCT8. |
Antibodies
View as table Download
Rabbit Polyclonal antibody to TCP1 theta (chaperonin containing TCP1, subunit 8 (theta))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 111 and 367 of TCP1 theta (Uniprot ID#P50990) |
Rabbit Polyclonal Anti-CCT8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CCT8 antibody is: synthetic peptide directed towards the N-terminal region of Human CCT8. Synthetic peptide located within the following region: LKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLF |
Rabbit Polyclonal Anti-CCT8 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCT8 antibody: synthetic peptide directed towards the C terminal of human CCT8. Synthetic peptide located within the following region: DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK |
CCT8 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 248-497 of human CCT8 (NP_001269837.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CCT8
Conjugates
- Unconjugated