Antibodies

View as table Download

Rabbit polyclonal anti-ANGPTL7 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ANGPTL7.

Rabbit Polyclonal Anti-ANGPTL7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANGPTL7 antibody: synthetic peptide directed towards the middle region of human ANGPTL7. Synthetic peptide located within the following region: NQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSP

Rabbit Polyclonal Anti-ANGPTL7 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ANGPTL7

ANGPTL7 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ANGPTL7 antibody is: synthetic peptide directed towards the N-terminal region of Human ANGL7

ANGPTL7 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ANGPTL7

ANGPTL7 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ANGPTL7