Antibodies

View as table Download

Rabbit Polyclonal ATOH8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATOH8 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human ATOH8.

Rabbit Polyclonal Anti-ATOH8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATOH8 antibody: synthetic peptide directed towards the N terminal of human ATOH8. Synthetic peptide located within the following region: PWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGL

Rabbit Polyclonal Anti-ATOH8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATOH8 antibody: synthetic peptide directed towards the C terminal of human ATOH8. Synthetic peptide located within the following region: LRIACNYILSLARLADLDYSADHSNLSFSECVQRCTRTLQAEGRAKKRKE