Antibodies

View as table Download

Anti-Human LEC Goat Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human LEC (CCL16)

Biotinylated Anti-Human LEC Goat Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human LEC (CCL16)

Rabbit Polyclonal anti-CCL16 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL16 antibody: synthetic peptide directed towards the N terminal of human CCL16. Synthetic peptide located within the following region: SLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKAL

Rabbit Polyclonal Anti-CCL16 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCL16

CCL16 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCL16

CCL16 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCL16