Antibodies

View as table Download

Rabbit polyclonal Cytochrome P450 4F11 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 4F11.

Rabbit Polyclonal anti-CYP4F11 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4F11 antibody: synthetic peptide directed towards the N terminal of human CYP4F11. Synthetic peptide located within the following region: FPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLI