Rabbit polyclonal Cytochrome P450 4F11 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 4F11. |
Rabbit polyclonal Cytochrome P450 4F11 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 4F11. |
Rabbit Polyclonal anti-CYP4F11 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP4F11 antibody: synthetic peptide directed towards the N terminal of human CYP4F11. Synthetic peptide located within the following region: FPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLI |
Mouse monoclonal Anti-Cytochrome P450 4F11 Clone F21 P6 F5
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |