Rabbit Polyclonal Anti-FCER1G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FCER1G antibody: synthetic peptide directed towards the N terminal of human FCER1G. Synthetic peptide located within the following region: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQV |
FCER1G Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-86 of human FCER1G (NP_004097.1). |
| Modifications | Unmodified |
Recombinant Anti-Fc epsilon R (Clone IB10)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-Fc epsilon R (Clone IB10)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-Fc epsilon R (Clone IE7)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-Fc epsilon R (Clone IE7)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Germany
Japan
United Kingdom
China