Antibodies

View as table Download

Rabbit Polyclonal Anti-HAL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAL antibody: synthetic peptide directed towards the C terminal of human HAL. Synthetic peptide located within the following region: EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK

Rabbit Polyclonal Anti-HAL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAL antibody: synthetic peptide directed towards the N terminal of human HAL. Synthetic peptide located within the following region: INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET

HAL Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human HAL (NP_002099.1).
Modifications Unmodified