Antibodies

View as table Download

Rabbit polyclonal anti-HEY2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HEY2.

Rabbit Polyclonal Anti-HEY2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HEY2 antibody: synthetic peptide directed towards the middle region of human HEY2. Synthetic peptide located within the following region: PMLPPNAAAAVAAATAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGA

HEY2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HEY2 (NP_036391.1).
Modifications Unmodified