Antibodies

View as table Download

MEF2D rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MEF2D

Rabbit Polyclonal Anti-MEF2D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MEF2D antibody: synthetic peptide directed towards the middle region of human MEF2D. Synthetic peptide located within the following region: GDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLD

Carrier-free (BSA/glycerol-free) MEF2D mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MEF2D mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MEF2D mouse monoclonal antibody, clone OTI10B4 (formerly 10B4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MEF2D rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MEF2D

MEF2D Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 431-521 of human MEF2D (NP_005911.1).
Modifications Unmodified

MEF2D mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MEF2D mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MEF2D mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MEF2D mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MEF2D mouse monoclonal antibody, clone OTI10B4 (formerly 10B4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MEF2D mouse monoclonal antibody, clone OTI10B4 (formerly 10B4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated