Rabbit Polyclonal Anti-SULT1B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SULT1B1 antibody: synthetic peptide directed towards the N terminal of human SULT1B1. Synthetic peptide located within the following region: MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSG |
Rabbit Polyclonal Anti-SULT1B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SULT1B1 antibody: synthetic peptide directed towards the N terminal of human SULT1B1. Synthetic peptide located within the following region: KRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFW |
Rabbit Polyclonal Anti-SULT1B1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SULT1B1 |
SULT1B1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SULT1B1 |
Germany
Japan
United Kingdom
China