Rabbit polyclonal anti-TLE2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TLE2. |
Rabbit polyclonal anti-TLE2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TLE2. |
Rabbit Polyclonal Anti-TLE2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TLE2 antibody: synthetic peptide directed towards the N terminal of human TLE2. Synthetic peptide located within the following region: VEEERPSGPGGGGKQRADEKEPSGPYESDEDKSDYNLVVDEDQPSEPPSP |
Carrier-free (BSA/glycerol-free) TLE2 mouse monoclonal antibody, clone OTI5A6 (formerly 5A6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TLE2 mouse monoclonal antibody, clone OTI5A6 (formerly 5A6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TLE2 mouse monoclonal antibody, clone OTI5A6 (formerly 5A6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |