Antibodies

Jump to Filters
View as table Download
LASS4 (CERS4) Rabbit Polyclonal Antibody
TA315794

USD 345.00

4 Weeks

Rabbit polyclonal anti-CERS4 (LASS4) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LASS4.
Cers4 Rabbit Polyclonal Antibody
TA329934

USD 310.00

5 Days

Rabbit Polyclonal Anti-LASS4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-LASS4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVAVRIVFERFVALPLSRWMGVQDPIRRKIKPNPVLEKYFLRMKQCPEET