Antibodies

Jump to Filters
View as table Download
ERGIC2 Rabbit Polyclonal Antibody
TA335552

USD 375.00

5 Days

Rabbit Polyclonal Anti-Ergic2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ergic2 Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ergic2. Synthetic peptide located within the following region: MRRLNRRKTLSLVKELDAFPKVPDSYVETSASGGTVSLIAFTTMALLTIM
ERGIC2 Rabbit Polyclonal Antibody
TA375973

USD 220.00

3 Weeks

ERGIC2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 55-310 of human ERGIC2 (NP_057654.2).
Modifications Unmodified