GTF2H4 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GTF2H4 |
GTF2H4 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GTF2H4 |
Rabbit Polyclonal Anti-GTF2H4 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2H4 antibody: synthetic peptide directed towards the N terminal of human GTF2H4. Synthetic peptide located within the following region: ALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIA |
GTF2H4 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GTF2H4 |
GTF2H4 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human GTF2H4 (NP_001508.1). |
Modifications | Unmodified |