Goat Polyclonal Antibody against PRDM4
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CSAVYSADESLSAHK, from the C Terminus of the protein sequence according to NP_036538. |
Goat Polyclonal Antibody against PRDM4
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CSAVYSADESLSAHK, from the C Terminus of the protein sequence according to NP_036538. |
Rabbit Polyclonal anti-Prdm4 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Prdm4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Prdm4. Synthetic peptide located within the following region: HLKTCKEPSSSSSAQEEEDDESEEEDLADSMRTEDCRMGSAVYSTDESLS |