VAMP8 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human VAMP8 (NP_003752.2). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-VAMP8 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Vamp8 antibody is: synthetic peptide directed towards the middle region of Rat Vamp8. Synthetic peptide located within the following region: LDHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVIICVIVLIILIL |
Germany
Japan
United Kingdom
China